PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013603204.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 346aa    MW: 38911 Da    PI: 8.2897
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013603204.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++ +G g+W+++++  g+ R++k+c++rw +yl
   XP_013603204.1 14 KGLWSPEEDEKLLNHITHHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding47.64e-1567109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg++++eE+ l+v+++  lG++ W+ Ia++++ gRt++++k+ w+
   XP_013603204.1  67 RGAFSPEEENLIVELHSVLGNR-WSQIASRLP-GRTDNEIKNLWN 109
                      89********************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-26664IPR009057Homeodomain-like
PROSITE profilePS5129418.376961IPR017930Myb domain
SuperFamilySSF466892.21E-2912108IPR009057Homeodomain-like
SMARTSM007172.7E-121363IPR001005SANT/Myb domain
PfamPF002494.5E-151461IPR001005SANT/Myb domain
CDDcd001674.87E-111761No hitNo description
PROSITE profilePS5129424.80962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2565117IPR009057Homeodomain-like
SMARTSM007172.3E-1366114IPR001005SANT/Myb domain
PfamPF002497.8E-1467109IPR001005SANT/Myb domain
CDDcd001676.87E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGRHSCCXKQ KLRKGLWSPE EDEKLLNHIT HHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SPEEENLIVE LHSVLGNRWS QIASRLPGRT DNEIKNLWNS SIKKKLKQRG  120
IDPNTHKPIS EVDKDKPTRS SNNDHKSPSS SAATNQDFFL ERPSDFSDYF GFQKLNFNSN  180
LTPESSLCSM VPGQFSLGNM VGSVFQTPVC VKPSISLPPD NSSSTVSRGD HTASNWEFQT  240
NNTSNFFENS GFSWSIPSSS VTKPNPNFEE VKWSEYLNTP FFNGSTVQSQ SSQQIYIKSE  300
GEYLAKVSNI TDPWSQSQNE NLSTPEASDV FSKDLQRMAV SFGQSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
1h8a_C1e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893310.0AC189331.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB037O12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013603204.10.0PREDICTED: LOW QUALITY PROTEIN: transcription repressor MYB6
TrEMBLA0A078H0U70.0A0A078H0U7_BRANA; BnaA08g26320D protein
STRINGBra030783.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.10.0myb domain protein 61